HORDB

ID: hor000194
Uniprot ID: O77220
Protein name: CHH precursor-related peptide
Gene name: CHH
Organism: Macrobrachium lanchesteri (Freshwater prawn) (Palaemon lanchesteri)
Family: Arthropod CHH/MIH/GIH/VIH hormone family
Source: animal
Expression: Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released.
Disease: NA
Comments: NA
Taxonomy: Macrobrachium (genus), Palaemonidae (family), Palaemonoidea (superfamily), Caridea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
GO BP: GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: WSLDGLARIEKLLSTSSSASAASPTRGQALNL
Length: 32
Propeptide: MIRSSVMGPTMFLVVLLLIASHQTSAWSLDGLARIEKLLSTSSSASAASPTRGQALNLKKRAILDQSCKGIFDRELFKKLDRVCDDCYNLYRKPYVAIDCREGCYQNLVFRQCIQDLQLMDQLDEYANAVQIVGK
Signal peptide: MIRSSVMGPTMFLVVLLLIASHQTSA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction (By similarity).
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000194_AF2.pdb

hor000194_ESM.pdb

Mass:	385483	Formula:	C142H238N42O48
Absent amino acids:	CFHMVY	Common amino acids:	S
pI:	9.69	Basic residues:	3
Polar residues:	12	Hydrophobic residues:	13
Hydrophobicity:	-2.81	Boman Index:	-4434
Half-Life:	2.8 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	100.94
Instability Index:	4388.13	Extinction Coefficient cystines:	5500
Absorbance 280nm:	177.42